SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54607077|ref|NP_075392.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54607077|ref|NP_075392.2|
Domain Number 1 Region: 270-384
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-19
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54607077|ref|NP_075392.2|
Sequence length 525
Comment ankyrin repeat domain-containing protein 57 [Homo sapiens]
Sequence
MEGPAEWGPEAALGPEAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELV
NAVATVRVDPADGAKYVHLKKRFCEGPSEPSGDPPRIQVTAEPEAPDGPAGPEARDRLPD
AAAPESLPGQGRELGEGEPPAPAHWPPLSAGARRKNSRRDVQPLPRTPAPGPSEDLELPP
HGCEEADRGSSLVGATAQRPARQNLRDLVMGSSPQLKRSVCPGGSSPGSSSGGGRGRGGG
DSDSASVASSSAEEESSGGGSVTLDPLEHAWMLSASDGKWDSLEGLLTCEPGLLVKRDFI
TGFTCLHWAAKHGRQELLAMLVNFANKHQLPVNIDARTSGGYTALHLAAMHGHVEVVKLL
VGAYDADVDIRDYSGKKASQYLSRSIAEEIKNLVGALDEGDGESAAGSGGGRWRLSKVLP
SHLITYKLSHALEDGGDHHHHHHSAEGWVGGKAKDPGRKASGSSSGRIKPRLNKIRFRTQ
IVHTTPSFRDPEQPLEGRGEEGVGEERPVKGHSPFTLRPKSNVFG
Download sequence
Identical sequences Q53LP3
NP_075392.2.87134 NP_075392.2.92137 ENSP00000365830 gi|54607077|ref|NP_075392.2| ENSP00000365830 ENSP00000365830 9606.ENSP00000365830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]