SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55749544|ref|NP_055446.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55749544|ref|NP_055446.2|
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily PX domain 3.14e-39
Family PX domain 0.0001
Further Details:      
 
Domain Number 2 Region: 166-225
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00038
Further Details:      
 
Domain Number 3 Region: 239-308
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-19
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 4 Region: 802-909
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-17
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 413-500
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-16
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1023-1103
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000171
Family SH3-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55749544|ref|NP_055446.2|
Sequence length 1105
Comment SH3 and PX domain-containing protein 2A [Homo sapiens]
Sequence
MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPI
EGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRF
FEARPEDVNPPKEDYGSSKRKSVWLSSWAESPKKDVTGADATAEPMILEQYVVVSNYKKQ
ENSELSLQAGEVVDVIEKNESGWWFVSTSEEQGWVPATYLEAQNGTRDDSDINTSKTGEE
EKYVTVQPYTSQSKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEGWAPASYLKKAKDDLP
TRKKNLAGPVEIIGNIMEISNLLNKKASGDKETPPAEGEGHEAPIAKKEISLPILCNASN
GSAVGVPDRTVSRLAQGSPAVARIAPQRAQISSPNLRTRPPPRRESSLGFQLPKPPEPPS
VEVEYYTIAEFQSCISDGISFRGGQKAEVIDKNSGGWWYVQIGEKEGWAPASYIDKRKKP
NLSRRTSTLTRPKVPPPAPPSKPKEAEEGPTGASESQDSPRKLKYEEPEYDIPAFGFDSE
PELSEEPVEDRASGERRPAQPHRPSPASSLQRARFKVGESSEDVALEEETIYENEGFRPY
AEDTLSARGSSGDSDSPGSSSLSLTRKNSPKSGSPKSSSLLKLKAEKNAQAEMGKNHSSA
SFSSSITINTTCCSSSSSSSSSLSKTSGDLKPRSASDAGIRGTPKVRAKKDADANAGLTS
CPRAKPSVRPKPFLNRAESQSQEKMDISTLRRQLRPTGQLRGGLKGSKSEDSELPPQTAS
EAPSEGSRRSSSDLITLPATTPPCPTKKEWEGPATSYMTCSAYQKVQDSEISFPAGVEVQ
VLEKQESGWWYVRFGELEGWAPSHYLVLDENEQPDPSGKELDTVPAKGRQNEGKSDSLEK
IERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSPPP
KDNNLSCALRRNESLTATDGLRGVRRNSSFSTARSAAAEAKGRLAERAASQGSDSPLLPA
QRNSIPVSPVRPKPIEKSQFIHNNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGW
WYCQILDGVKPFKGWVPSNYLEKKN
Download sequence
Identical sequences ENSP00000348215 NP_055446.2.87134 NP_055446.2.92137 gi|55749544|ref|NP_055446.2| ENSP00000348215 9606.ENSP00000348215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]