SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55770892|ref|NP_001006944.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55770892|ref|NP_001006944.1|
Domain Number 1 Region: 31-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-70
Family Ephrin receptor ligand binding domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 327-429
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000931
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 3 Region: 256-325,376-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000718
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55770892|ref|NP_001006944.1|
Sequence length 495
Comment ephrin type-A receptor 8 isoform 2 precursor [Homo sapiens]
Sequence
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAGRRRNSVPQRPGPPASPASDPSRDQSSAGDVLWAFRQVPLWP
CAPHQDPELEALHCL
Download sequence
Identical sequences ENSP00000363775 ENSP00000440274 NP_001006944.1.87134 NP_001006944.1.92137 ENSP00000363775 ENSP00000440274 gi|55770892|ref|NP_001006944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]