SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56090539|ref|NP_001007534.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56090539|ref|NP_001007534.1|
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-25
Family Ankyrin repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56090539|ref|NP_001007534.1|
Sequence length 154
Comment dysferlin-interacting protein 1 [Homo sapiens]
Sequence
MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATI
HPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLG
ADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
Download sequence
Identical sequences H2QE31 Q86WC6
ENSP00000331065 ENSP00000331065 gi|56090539|ref|NP_001007534.1| 9606.ENSP00000331065 ENSP00000331065 NP_001007534.1.87134 NP_001007534.1.92137 XP_003831158.1.60992 XP_523747.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]