SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56549091|ref|NP_061332.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|56549091|ref|NP_061332.2|
Domain Number - Region: 178-229
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0392
Family Intermediate filament protein, coiled coil region 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56549091|ref|NP_061332.2|
Sequence length 241
Comment B-cell receptor-associated protein 29 isoform b [Homo sapiens]
Sequence
MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI
VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL
VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL
VEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR
L
Download sequence
Identical sequences E9PAJ1 G3SAF0 Q9UHQ4
NP_061332.2.87134 NP_061332.2.92137 XP_004046074.1.27298 XP_008961817.1.60992 ENSP00000005259 ENSP00000368412 ENSP00000005259 ENSP00000368412 gi|56549091|ref|NP_061332.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]