SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56550059|ref|NP_001008226.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56550059|ref|NP_001008226.1|
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily RING/U-box 1.2e-18
Family RING finger domain, C3HC4 0.0000121
Further Details:      
 
Domain Number 2 Region: 103-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.42e-16
Family Canonical RBD 0.0000113
Further Details:      
 
Weak hits

Sequence:  gi|56550059|ref|NP_001008226.1|
Domain Number - Region: 192-218
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0186
Family CCCH zinc finger 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56550059|ref|NP_001008226.1|
Sequence length 572
Comment CCR4-NOT transcription complex subunit 4 isoform b [Homo sapiens]
Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKL
LQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSLSIGNGDNSQQISNSDTPSPP
PGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSD
WPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKEL
SVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHR
AVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAG
EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA
Download sequence
Identical sequences A0A024R776 A0A2J8V3R2
ENSP00000399108 gi|56550059|ref|NP_001008226.1| ENSP00000399108 NP_001008226.1.87134 NP_001008226.1.92137 XP_009241516.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]