SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5729720|ref|NP_006678.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5729720|ref|NP_006678.1|
Domain Number 1 Region: 211-435
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.24e-70
Family Actin/HSP70 0.0000026
Further Details:      
 
Domain Number 2 Region: 70-217
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.3e-46
Family Actin/HSP70 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5729720|ref|NP_006678.1|
Sequence length 435
Comment actin-like protein 7A [Homo sapiens]
Sequence
MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAA
KERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQ
ELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNR
EKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITG
RLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCCFVALDPIEEKKVPLSEHTIR
YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL
CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVLPERDSAVWTGGSILASLQGFQPLWVHRF
EYEEHGPFFLYRRCF
Download sequence
Identical sequences A0A140VK03 Q9Y615
ENSP00000334300 9606.ENSP00000334300 NP_006678.1.87134 NP_006678.1.92137 ENSP00000334300 ENSP00000334300 gi|5729720|ref|NP_006678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]