SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5729722|ref|NP_006677.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5729722|ref|NP_006677.1|
Domain Number 1 Region: 190-415
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.7e-65
Family Actin/HSP70 0.00000131
Further Details:      
 
Domain Number 2 Region: 49-197
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.11e-45
Family Actin/HSP70 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5729722|ref|NP_006677.1|
Sequence length 415
Comment actin-like protein 7B [Homo sapiens]
Sequence
MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQY
CKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIV
VDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTS
QSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEA
GHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSE
MLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELS
LLCPGDSPAVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC
Download sequence
Identical sequences A0A140VKC6 Q9Y614
NP_006677.1.87134 NP_006677.1.92137 9606.ENSP00000363799 ENSP00000363799 gi|5729722|ref|NP_006677.1| ENSP00000363799 ENSP00000363799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]