SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5729877|ref|NP_006588.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5729877|ref|NP_006588.1|
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.12e-73
Family Actin/HSP70 0.0000000134
Further Details:      
 
Domain Number 2 Region: 192-382
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.42e-70
Family Actin/HSP70 0.0000000136
Further Details:      
 
Domain Number 3 Region: 386-543
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.24e-66
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000000411
Further Details:      
 
Domain Number 4 Region: 538-619
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 1.44e-32
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5729877|ref|NP_006588.1|
Sequence length 646
Comment heat shock cognate 71 kDa protein isoform 1 [Homo sapiens]
Sequence
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
Download sequence
Identical sequences A0A0D9S441 A0A0P6J944 A0A1S3A423 A0A1S3EMC9 A0A250YKN8 A0A2I3HNE7 A0A2I3SCB6 A0A2K5EK34 A0A2K5H9H0 A0A2K5WNF9 A0A2K5YIX8 A0A2K6D6I6 A2Q0Z1 B2KI81 D2GYC0 E2R0T6 G3RYM8 H0V2J1 I0FRC9 I3M2W9 M3VW17 P11142 Q5RA83 Q71U34 V9HW22
ENSSTOP00000003365 ENSSTOP00000003365 ENSNLEP00000009039 10141.ENSCPOP00000003760 9544.ENSMMUP00000006240 9598.ENSPTRP00000007540 9600.ENSPPYP00000004564 9606.ENSP00000227378 9615.ENSCAFP00000017166 ENSCAFP00000017166 ENSPPYP00000004564 ENSCPOP00000003760 ENSFCAP00000001048 gi|5729877|ref|NP_006588.1| ENSGGOP00000008191 ENSMMUP00000006240 ENSAMEP00000008881 ENSAMEP00000008881 ENSGGOP00000020917 ENSCPOP00000003760 ENSP00000227378 ENSP00000432083 ENSP00000437125 ENSP00000404372 ENSPPYP00000004564 ENSMMUP00000006240 ENSCAFP00000017166 NP_001075247.1.31192 NP_001125783.1.23681 NP_001248586.1.72884 NP_006588.1.87134 NP_006588.1.92137 XP_002708378.1.1745 XP_003253350.1.23891 XP_003313441.2.37143 XP_003472802.1.53824 XP_003992527.1.62641 XP_004052356.1.27298 XP_004413595.1.74151 XP_004585034.1.84141 XP_004689214.1.23501 XP_004870956.1.39548 XP_005328449.1.77405 XP_005378436.1.28644 XP_005580033.1.63531 XP_005619707.1.84170 XP_007091261.1.5354 XP_007529022.1.11023 XP_008019453.1.81039 XP_008019454.1.81039 XP_008019455.1.81039 XP_008019456.1.81039 XP_008157182.1.99482 XP_008688169.1.72690 XP_008688170.1.72690 XP_008971636.1.60992 XP_009245455.1.23681 XP_009245456.1.23681 XP_010616350.1.5607 XP_011215233.1.58354 XP_011381300.1.92234 XP_011541100.1.92137 XP_011730446.1.29376 XP_011782383.1.43180 XP_011820385.1.47321 XP_012325687.1.9421 XP_012422534.1.74151 XP_012865104.1.60039 XP_014699146.1.49734 XP_014929592.1.86478 XP_015345200.1.40921 XP_015987719.1.101085 XP_017501836.1.32401 XP_019289047.1.44245 XP_019488987.1.44202 XP_019574142.1.88060 XP_020037181.1.5219 XP_021552250.1.83697 ENSNLEP00000009039 ENSP00000227378 ENSP00000432083 ENSP00000437125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]