SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58530848|ref|NP_001011546.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58530848|ref|NP_001011546.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.06e-46
Family Cofilin-like 0.0000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|58530848|ref|NP_001011546.1|
Sequence length 148
Comment destrin isoform b [Homo sapiens]
Sequence
MKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPE
KDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQA
NGPEDLNRACIAEKLGGSLIVAFEGCPV
Download sequence
Identical sequences A0A1U7SIH1 A0A2I2Z9J0 A0A2J8MSY5 A0A2J8VD93 G1REY7 L9L8B7
NP_001011546.1.87134 NP_001011546.1.92137 XP_004061887.1.27298 XP_004090227.1.23891 XP_004635661.1.9945 XP_004697872.1.18182 XP_005634815.1.84170 XP_005860647.1.60319 XP_005904629.1.15283 XP_006088038.1.53796 XP_006143709.1.99106 XP_006194958.1.101512 XP_006206242.1.17985 XP_006776177.1.95426 XP_006902143.1.29581 XP_008047664.1.4292 XP_008523593.1.77740 XP_009231597.1.23681 XP_009231598.1.23681 XP_010335058.1.74449 XP_010860889.1.44457 XP_010860890.1.44457 XP_010971202.1.22495 XP_010984373.1.51371 XP_011527446.1.92137 XP_011818196.1.43180 XP_011818205.1.43180 XP_012926201.1.39548 XP_013015424.1.53824 XP_014590509.1.31192 XP_014645552.1.5094 XP_014693043.1.49734 XP_015329514.1.76553 XP_016067481.1.3490 XP_016792966.1.37143 XP_016792967.1.37143 XP_017368196.1.71028 XP_017827463.1.60252 XP_019481754.1.44202 XP_019661339.1.58354 XP_019828770.1.53367 XP_020035091.1.5219 XP_020932974.1.46622 XP_021529246.1.9421 ENSP00000476975 ENSP00000476975 gi|58530848|ref|NP_001011546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]