SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59806361|ref|NP_001012279.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|59806361|ref|NP_001012279.1|
Domain Number - Region: 700-735
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00785
Family Delta-sleep-inducing peptide immunoreactive peptide 0.007
Further Details:      
 
Domain Number - Region: 347-385
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0557
Family Leucine zipper domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59806361|ref|NP_001012279.1|
Sequence length 947
Comment hypothetical protein LOC387104 precursor [Homo sapiens]
Sequence
MSQPPIGGAAPATAAASPAAAATEARLHPEGSSRKQQRAQSPARPRDSSLRQTIAATRSP
VGAGTKLNSVRQQQLQQQQQQGNKTGSRTGPPASIRGGGGGAEKATPLAPKGAAPGAVQP
VAGAEAAPAATLAALGGRRPGPPEEPPRELESVPSKLGEPPPLGEGGGGGGEGGGAGGGS
GEREGGAPQPPPPRGWRGKGVRAQQRGGSGGEGASPSPSSSSAGKTPGTGSRNSGSGVAG
GGSGGGGSYWKEGCLQSELIQFHLKKERAAAAAAAAQMHAKNGGGSSSRSSPVSGPPAVC
ETLAVASASPMAAAAEGPQQSAEGSASGGGMQAAAPPSSQPHPQQLQEQEEMQEEMEKLR
EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERKR
LRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVE
IAKQALQNELEKMKELSLKRRGSKDLPKSEKKAQQTPTEEDNEDLKCQLQFVKEEAALMR
KKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANI
LGRKIVELEVENRGLKAELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLR
RNVADLEEQNKRITAELNKYKYKSGGHDSARHHDNAKTEALQEELKAARLQINELSGKVM
QLQYENRVLMSNMQRYDLASHLGIRGSPRDSDAESDAGKKESDDDSRPPHRKREGPIGGE
SDSEEVRNIRCLTPTRSFYPAPGPWPKSFSDRQQMKDIRSEAERLGKTIDRLIADTSTII
TEARIYVANGDLFGLMDEEDDGSRIREHELLYRINAQMKAFRKELQTFIDRLEVPKSADD
RGAEEPISVSQMFQPIILLILILVLFSSLSYTTIFKLVFLFTLFFVL
Download sequence
Identical sequences Q5TF21
ENSP00000357251 ENSP00000434570 ENSP00000451768 ENSP00000455908 gi|59806361|ref|NP_001012279.1| ENSP00000434570 ENSP00000451768 ENSP00000455908 NP_001012279.1.87134 NP_001012279.1.92137 ENSP00000357251 ENSP00000455908 9606.ENSP00000357251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]