SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|60218887|ref|NP_001012428.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60218887|ref|NP_001012428.1|
Domain Number 1 Region: 40-260
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-51
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 259-301
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000144
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|60218887|ref|NP_001012428.1|
Sequence length 302
Comment ankyrin repeat and SOCS box protein 11 isoform b [Homo sapiens]
Sequence
MLQLTGENEKNCEVSERIRRSGPWKEISFGDYICHTFQGDCWADRSPLHEAAAQGRLLAL
KTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCS
GSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLY
VACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQG
KSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLL
YQ
Download sequence
Identical sequences ENSP00000343408 ENSP00000445465 gi|60218887|ref|NP_001012428.1| NP_001012428.1.87134 NP_001012428.1.92137 ENSP00000343408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]