SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|60460920|ref|NP_001012419.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60460920|ref|NP_001012419.1|
Domain Number 1 Region: 34-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.3e-56
Family Ankyrin repeat 0.00027
Further Details:      
 
Weak hits

Sequence:  gi|60460920|ref|NP_001012419.1|
Domain Number - Region: 648-751
Classification Level Classification E-value
Superfamily Tropomyosin 0.00333
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|60460920|ref|NP_001012419.1|
Sequence length 823
Comment ankyrin repeat domain-containing protein 20A3 [Homo sapiens]
Sequence
MKLFGFGSRRGQTAQGSIDHVYTGSGYRIRDSELQKIHRAAVKGDAAEVERCLARRSGDL
DALDKQHRTALHLACASGHVQVVTLLVNRKCQIDVCDKENRTPLIQAVHCQEEACAVILL
EHGANPNLKDIYGNTALHYAVYSESTSLAEKLLSHGAHIEALDKDNNTPLLFAIICKKEK
MVEFLLKRKASSHAVDRLRRSALMLAVYYDSPGIVNILLKQNIDVFAQDMCGRDAEDYAI
SHHLTKIQQQILEHKKKILKKEKSDVGSSDESAVSIFHELRVDSLPASDDKDLNVATKQC
VPEKVSEPLPGSSHEKGNRIVNGQGEGPPAKHPSLKPSTEVEDPAVKGAVQRKNVQTLRA
EQALPVASEEEQERHERSEKKQPQVKEGNNTNKSEKIQLSENICDSTSSAAAGRLTQQRK
IGKTYPQQFPKKLKEEHDRCTLKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAKQLE
PTVQSLEMKSKTARNTPNRDFHNHEEMKGLMDENCILKADIAILRQEICTMKNDNLEKEN
KYLKDIKIVKETNAALEKYIKLNEEMITETAFRYQQELNYLKAENTRLNAELLKEKESKK
RLEADIESYQSRLAAAISKHSESVKTERNLKLALERTRDVSVQVEMSSAISKVKDENEFL
TEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNDLSQTQQQTQEMKEMYQNAEAKV
NNSTGKWNCVEERICHLQRENAWLVQQLDDVHQKEDHKEIVTNIQRGFIESGKKDLVLEE
KSKKLMNECDHLKESLFQYEREKTEGVVSIKEDKYFQTSRKTI
Download sequence
Identical sequences Q5VUR7
9606.ENSP00000254835 gi|60460920|ref|NP_001012419.1| NP_001012419.1.92137 ENSP00000254835 ENSP00000482325 ENSP00000254835 HR5434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]