SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|61744467|ref|NP_059992.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|61744467|ref|NP_059992.3|
Domain Number 1 Region: 295-555
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-57
Family YWTD domain 0.0000000155
Further Details:      
 
Domain Number 2 Region: 167-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 3 Region: 46-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 84-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 5 Region: 119-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 6 Region: 206-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 7 Region: 247-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000911
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 8 Region: 566-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000023
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|61744467|ref|NP_059992.3|
Sequence length 700
Comment low-density lipoprotein receptor-related protein 8 isoform 3 precursor [Homo sapiens]
Sequence
MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCI
PSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEA
TCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATSLGTCRGDEFQCGDG
TCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLL
DQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGKSPSLIFTNR
HEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQE
VLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDP
LRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLS
SIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENL
NNPHDIVIFHELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGP
DMKRCYRDANEDSKMGSTVTAAVIGIIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNP
VYRKTTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences ENSP00000346391 gi|61744467|ref|NP_059992.3| NP_059992.3.87134 NP_059992.3.92137 ENSP00000346391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]