SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|63055057|ref|NP_001017992.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|63055057|ref|NP_001017992.1|
Domain Number 1 Region: 147-376
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.78e-99
Family Actin/HSP70 0.00000000218
Further Details:      
 
Domain Number 2 Region: 5-153
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.84e-64
Family Actin/HSP70 0.000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|63055057|ref|NP_001017992.1|
Sequence length 376
Comment beta-actin-like protein 2 [Homo sapiens]
Sequence
MTDNELSALVVDNGSGMCKAGFGGDDAPRAVFPSMIGRPRHQGVMVGMGQKDCYVGDEAQ
SKRGVLTLKYPIEHGVVTNWDDMEKIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKM
TQIMFEAFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYNFTTTAEREIVRDVKEKLCYVALDFEQEMVRAAASSSPERS
YELPDGQVITIGNERFRCPEAIFQPSFLGIESSGIHETTFNSIMKCDVDIRKDLYANTVL
SGGSTMYPGIADRMQKEIITLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDEAGPPIVHRKCF
Download sequence
Identical sequences Q562R1
gi|63055057|ref|NP_001017992.1| ENSP00000416706 ENSP00000416706 9606.ENSP00000416706 ENSP00000416706 NP_001017992.1.87134 NP_001017992.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]