SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|63252913|ref|NP_001738.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|63252913|ref|NP_001738.2|
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.38e-33
Family Gelsolin-like 0.00000141
Further Details:      
 
Domain Number 2 Region: 134-238
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.25e-28
Family Gelsolin-like 0.00000156
Further Details:      
 
Domain Number 3 Region: 244-347
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.32e-26
Family Gelsolin-like 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|63252913|ref|NP_001738.2|
Sequence length 348
Comment macrophage-capping protein [Homo sapiens]
Sequence
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSH
LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
KSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLT
ADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK
Download sequence
Identical sequences P40121 V9HW69
ENSP00000263867 ENSP00000263867 ENSP00000386315 ENSP00000386965 9606.ENSP00000263867 NP_001243068.1.87134 NP_001243068.1.92137 NP_001307661.1.87134 NP_001307661.1.92137 NP_001307662.1.87134 NP_001307662.1.92137 NP_001738.2.87134 NP_001738.2.92137 XP_011531424.1.92137 XP_011531425.1.92137 gi|63252913|ref|NP_001738.2| ENSP00000263867 ENSP00000386315 ENSP00000386965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]