SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|65301119|ref|NP_001018064.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|65301119|ref|NP_001018064.1|
Domain Number 1 Region: 424-684
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-57
Family YWTD domain 0.0000000155
Further Details:      
 
Domain Number 2 Region: 166-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 259-295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 4 Region: 293-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 5 Region: 46-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 6 Region: 85-128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 7 Region: 119-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 8 Region: 335-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 9 Region: 205-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 376-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 11 Region: 695-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|65301119|ref|NP_001018064.1|
Sequence length 904
Comment low-density lipoprotein receptor-related protein 8 isoform 4 precursor [Homo sapiens]
Sequence
MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCI
PSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEA
TCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCL
AAVFVCDGDDDCGDGSDERGCADPACGPREFRCGGDGGGACIPERWVCDRQFDCEDRSDE
AAELCGRPGPGATSAPAACATASQFACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCR
GDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFEC
TCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK
SPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMD
KASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLS
EPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYW
VDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGL
EISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCA
CPDTMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTYQNHSTETPSL
TAAVPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALL
CMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPARVALSLED
DGLP
Download sequence
Identical sequences NP_001018064.1.87134 NP_001018064.1.92137 ENSP00000360509 gi|65301119|ref|NP_001018064.1| ENSP00000360509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]