SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|65786661|ref|NP_001018082.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|65786661|ref|NP_001018082.1|
Domain Number 1 Region: 578-752
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-26
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 914-1021
Classification Level Classification E-value
Superfamily POZ domain 3.84e-23
Family BTB/POZ domain 0.0036
Further Details:      
 
Domain Number 3 Region: 201-251,329-389
Classification Level Classification E-value
Superfamily Histone-fold 1.39e-20
Family Nucleosome core histones 0.0098
Further Details:      
 
Domain Number 4 Region: 123-191
Classification Level Classification E-value
Superfamily Histone-fold 0.00000279
Family Nucleosome core histones 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|65786661|ref|NP_001018082.1|
Sequence length 1104
Comment ankyrin repeat and BTB/POZ domain-containing protein BTBD11 isoform a [Homo sapiens]
Sequence
MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMH
SRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELEALLLRSRDPRAGPAV
PGGLPKDALAKLSTLVSRALVRIAKEAQRLSLRFAKCTKYEIQSAMEIVLSWGLAAHCTA
AALAALSLYNMSSAGGDRLGRGKSARCGLTFSVGRVYRWMVDSRVALRIHEHAAIYLTAC
MESLFRDIYSRVVASGVPRSCSGPGSGSGSGPGPSSGPGAAPAADKEREAPGGGAASGGA
CSAASSASGGSSCCAPPAAAAAAVPPAAAANHHHHHHHALHEAPKFTVETLEHTVNNDSE
IWGLLQPYQHLICGKNASGVLCLPDSLNLHRDPQRSNKPGELPMFSQSELRTIEQSLLAT
RVGSIAELSDLVSRAMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQME
WENPNVEPSKVNLQVERPFLVLPPLMEWIRVAVAHAGHRRSFSMDSDDVRQAARLLLPGV
DCEPRQLRADDCFCASRKLDAVAIEAKFKQDLGFRMLNCGRTDLVKQAVSLLGPDGINTM
SEQGMTPLMYACVRGDEAMVQMLLDAGADLNVEVVSTPHKYPSVHPETRHWTALTFAVLH
GHIPVVQLLLDAGAKVEGSVEHGEENYSETPLQLAAAVGNFELVSLLLERGADPLIGTMY
RNGISTTPQGDMNSFSQAAAHGHRNVFRKLLAQPEKEKSDILSLEEILAEGTDLAETAPP
PLCASRNSKAKLRALREAMYHSAEHGYVDVTIDIRSIGVPWTLHTWLESLRIAFQQHRRP
LIQCLLKEFKTIQEEEYTEELVTQGLPLMFEILKASKNEVISQQLCVIFTHCYGPYPIPK
LTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALLSSKPTNDG
TCIEIGYVKYSIFQLVMQYLYYGGPESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAK
SINTDNCVDIYNHAKFLGVTELSAYCEGYFLKNMMVLIENEAFKQLLYDKNGEGTGQDVL
QDLQRTLAIRIQSIHLSSSKGSVV
Download sequence
Identical sequences A6QL63
ENSP00000280758 9606.ENSP00000280758 ENSP00000280758 NP_001018082.1.87134 NP_001018082.1.92137 gi|65786661|ref|NP_001018082.1| ENSP00000280758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]