SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|6598323|ref|NP_001485.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6598323|ref|NP_001485.2|
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.01e-63
Family GDI-like N domain 0.000000000246
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000107
Family GDI-like N domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|6598323|ref|NP_001485.2|
Sequence length 445
Comment rab GDP dissociation inhibitor beta isoform 1 [Homo sapiens]
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPG
SPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQD
VIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI
YKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences A0A2I3GNY5 P50395 Q6IAT1
ENSNLEP00000014001 gi|6598323|ref|NP_001485.2| NP_001485.2.87134 NP_001485.2.92137 XP_003257651.1.23891 Hs6598323___KOG1439 9606.ENSP00000369538 ENSP00000369538 ENSP00000369538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]