SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66082554|ref|NP_150643.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66082554|ref|NP_150643.2|
Domain Number 1 Region: 254-514
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-57
Family YWTD domain 0.0000000155
Further Details:      
 
Domain Number 2 Region: 46-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 81-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 4 Region: 119-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 5 Region: 170-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 6 Region: 206-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 7 Region: 525-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66082554|ref|NP_150643.2|
Sequence length 793
Comment low-density lipoprotein receptor-related protein 8 isoform 2 precursor [Homo sapiens]
Sequence
MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCI
PSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEA
TCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATWLNECLHNNGGCSHI
CTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLL
TKNCKAAAGKSPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLS
YRKIYSAYMDKASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGR
RRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGIT
LDLLSQRLYWVDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEA
IFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGCEYLCLPAPQI
SSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTY
QNHSTETPSLTAAVPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGI
IVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVY
PAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKS
KRVALSLEDDGLP
Download sequence
Identical sequences gi|66082554|ref|NP_150643.2| ENSP00000334522 NP_150643.2.87134 NP_150643.2.92137 ENSP00000334522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]