SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|6679189|ref|NP_031390.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6679189|ref|NP_031390.1|
Domain Number 1 Region: 37-128
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.57e-21
Family Supernatant protein factor (SPF), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|6679189|ref|NP_031390.1|
Sequence length 217
Comment transmembrane emp24 domain-containing protein 3 precursor [Homo sapiens]
Sequence
MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITG
GHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQV
GDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVS
YWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
Download sequence
Identical sequences A0A140VKD1 Q9Y3Q3
gi|6679189|ref|NP_031390.1| 1302 ENSP00000299705 9606.ENSP00000299705 NP_031390.1.87134 NP_031390.1.92137 ENSP00000299705 ENSP00000299705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]