SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66864913|ref|NP_001019800.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66864913|ref|NP_001019800.1|
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000527
Further Details:      
 
Domain Number 2 Region: 428-586
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000543
Further Details:      
 
Domain Number 3 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.00000111
Further Details:      
 
Domain Number 4 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|66864913|ref|NP_001019800.1|
Sequence length 609
Comment neuropilin-1 isoform c [Homo sapiens]
Sequence
MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
INEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEGGTTVLATEKPTVI
DSTIQSGIK
Download sequence
Identical sequences NP_001019800.1.87134 NP_001019800.1.92137 gi|66864913|ref|NP_001019800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]