SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67003576|ref|NP_001019846.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67003576|ref|NP_001019846.1|
Domain Number 1 Region: 13-242
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.6e-53
Family Actin/HSP70 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|67003576|ref|NP_001019846.1|
Sequence length 245
Comment putative uncharacterized actin family protein C20orf134 [Homo sapiens]
Sequence
MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLL
VAANPDLLQQALPRKAITHLKKRSCYVSLDFEGDLRDPARHHPASFSVGNGCCVCLSSER
FRCPEPIFQPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLD
KELEAQCRRHGYAALRPHLVAKHGRGMAVWTGGSMVASLHSFQRRWITRAMYQECGSRLL
YDVFN
Download sequence
Identical sequences H2R917 Q5JWF8
ENSP00000329647 9606.ENSP00000329647 gi|67003576|ref|NP_001019846.1| ENSPTRP00000052258 ENSPTRP00000052258 ENSP00000329647 ENSP00000329647 NP_001019846.1.87134 NP_001019846.1.92137 XP_008955434.1.60992 XP_009435341.1.37143 XP_016793216.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]