SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67782365|ref|NP_005547.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67782365|ref|NP_005547.3|
Domain Number 1 Region: 321-398
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.02e-23
Family Intermediate filament protein, coiled coil region 0.00036
Further Details:      
 
Domain Number 2 Region: 90-124
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000068
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 211-322
Classification Level Classification E-value
Superfamily Prefoldin 0.00000068
Family Prefoldin 0.013
Further Details:      
 
Domain Number 4 Region: 136-199
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000377
Family Intermediate filament protein, coiled coil region 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67782365|ref|NP_005547.3|
Sequence length 469
Comment keratin, type II cytoskeletal 7 [Homo sapiens]
Sequence
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG
AGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLE
TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY
EDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQI
SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD
LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA
LQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG
GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Download sequence
Identical sequences P08729
NP_005547.3.87134 NP_005547.3.92137 ENSP00000329243 ENSP00000329243 gi|67782365|ref|NP_005547.3| 9606.ENSP00000329243 ENSP00000329243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]