SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67906195|ref|NP_775822.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67906195|ref|NP_775822.3|
Domain Number 1 Region: 12-28,65-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.4e-54
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 293-420
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.95e-28
Family Ankyrin repeat 0.00053
Further Details:      
 
Domain Number 3 Region: 772-835
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000118
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|67906195|ref|NP_775822.3|
Sequence length 871
Comment ankyrin repeat and SAM domain-containing protein 6 [Homo sapiens]
Sequence
MGEGGLPPAFQLLLRACDQGDTETARRLLEPGAAEPAERGAEPEAGAEPAGAEVAGPGAA
AAGAVGAPVPVDCSDEAGNTALQFAAAGGHEPLVRFLLRRGASVNSRNHYGWSALMQAAR
FGHVSVAHLLLDHGADVNAQNRLGASVLTVASRGGHLGVVKLLLEAGAFVDHHHPSGEQL
GLGGSRDEPLDITALMAAIQHGHEAVVRLLMEWGADPNHAARTVGWSPLMLAALTGRLGV
AQQLVEKGANPDHLSVLEKTAFEVALDCKHRDLVDYLDPLTTVRPKTDEEKRRPDIFHAL
KMGNFQLVKEIADEDPSHVNLVNGDGATPLMLAAVTGQLALVQLLVERHADVDKQDSVHG
WTALMQATYHGNKEIVKYLLNQGADVTLRAKNGYTAFDLVMLLNDPDTELVRLLASVCMQ
VNKDKGRPSHQPPLPHSKVRQPWSIPVLPDDKGGLKSWWNRMSNRFRKLKLMQTLPRGLS
SNQPLPFSDEPEPALDSTMRAAPQDKTSRSALPDAAPVTKDNGPGSTRGEKEDTLLTTML
RNGAPLTRLPSDKLKAVIPPFLPPSSFELWSSDRSRTRHNGKADPMKTALPQRASRGHPV
GGGGTDTTPVRPVKFPSLPRSPASSANSGNFNHSPHSSGGSSGVGVSRHGGELLNRSGGS
IDNVLSQIAAQRKKAAGLLEQKPSHRSSPVGPAPGSSPSELPASPAGGSAPVGKKLETSK
RPPSGTSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTG
ILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRE
RQILQETIHNFHSSFESSASNTRAPGNSPCA
Download sequence
Identical sequences Q68DC2
NP_775822.3.87134 NP_775822.3.92137 XP_016869934.1.92137 ENSP00000297837 gi|67906195|ref|NP_775822.3| 9606.ENSP00000297837 ENSP00000297837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]