SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68131557|ref|NP_056014.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68131557|ref|NP_056014.2|
Domain Number 1 Region: 12-284
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-80
Family Ankyrin repeat 0.0000244
Further Details:      
 
Domain Number 2 Region: 619-978
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.65e-74
Family Ankyrin repeat 0.00000558
Further Details:      
 
Domain Number 3 Region: 288-525
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.69e-59
Family Ankyrin repeat 0.0000575
Further Details:      
 
Domain Number 4 Region: 485-614
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-22
Family Ankyrin repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|68131557|ref|NP_056014.2|
Sequence length 1053
Comment serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A isoform a [Homo sapiens]
Sequence
MAFLKLRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELL
ILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAV
KCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWA
AYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGN
TPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN
MKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLIT
SGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLEC
LNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAAT
SDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTD
MLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVD
VLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLS
VLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGR
TPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV
FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQ
LLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSK
GHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGY
TPALACAPNKDVADCLALILATMMPVSSSSPLSSLTFNAINRYTNTSKTVSFEALPIMRN
EPSSYCSFNNIGGEQEYLYTDVDELNDSDSETY
Download sequence
Identical sequences A0A024R2G8 A0A2J8U3X7 O15084
ENSP00000382379 ENSP00000397341 NP_056014.2.87134 NP_056014.2.92137 XP_002814074.1.23681 gi|68131557|ref|NP_056014.2| 9606.ENSP00000382379 ENSP00000382379 ENSP00000397341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]