SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|6857826|ref|NP_006702.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6857826|ref|NP_006702.1|
Domain Number 1 Region: 105-235
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-23
Family Canonical RBD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|6857826|ref|NP_006702.1|
Sequence length 305
Comment RNA-binding protein with serine-rich domain 1 [Homo sapiens]
Sequence
MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD
KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSS
SGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEI
FSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLA
PWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSS
SNSSR
Download sequence
Identical sequences A0A096NL34 A0A0P6JTI3 A0A1U7SZF7 A0A250YF13 A0A2I2ZM53 A0A2J8S8B4 A0A2K5K2D6 A0A2K5KSF8 A0A2K5ZCD2 A0A2K6TTC1 D3DU92 F6XEW2 F7HF91 F7J0L1 G1MHN0 G1PVF5 G7Q091 H9YZ61 Q15287 Q4R5N1 Q5NVM8 Q99M28
ENSP00000301730 ENSP00000315859 ENSP00000380275 ENSP00000457723 ENSP00000457820 ENSP00000301730 ENSP00000315859 ENSP00000380275 ENSP00000457723 ENSP00000457820 ENSDNOP00000012471 ENSTTRP00000007784 ENSCJAP00000027588 ENSPANP00000013692 ENSAMEP00000018865 NP_001073596.1.92730 NP_001273554.1.87134 NP_001273554.1.92137 NP_006702.1.87134 NP_006702.1.92137 NP_033096.2.92730 NP_542161.1.87134 NP_542161.1.92137 XP_001498799.1.31192 XP_002926566.1.58354 XP_003928458.1.74449 XP_003928460.1.74449 XP_004270340.1.21590 XP_004403227.1.74151 XP_004403228.1.74151 XP_004438220.1.5094 XP_004438221.1.5094 XP_004470082.1.11602 XP_004470083.1.11602 XP_004470084.1.11602 XP_004864696.1.39548 XP_004864697.1.39548 XP_005255105.1.92137 XP_005255106.1.92137 XP_005349238.1.66349 XP_005349239.1.66349 XP_005591024.1.63531 XP_005591028.1.63531 XP_005621745.1.84170 XP_005869410.1.60319 XP_005869411.1.60319 XP_005869412.1.60319 XP_006100980.1.53796 XP_006100981.1.53796 XP_006100982.1.53796 XP_006763957.1.95426 XP_006763958.1.95426 XP_006979003.1.50099 XP_006979004.1.50099 XP_006979005.1.50099 XP_007100118.1.24612 XP_007100119.1.24612 XP_007100120.1.24612 XP_007181696.1.59432 XP_007181697.1.59432 XP_007181698.1.59432 XP_007453595.1.90284 XP_007980796.1.81039 XP_007980797.1.81039 XP_007980804.1.81039 XP_007980813.1.81039 XP_007980819.1.81039 XP_008049512.1.4292 XP_008049513.1.4292 XP_008540689.1.77740 XP_008694964.1.72690 XP_010337360.1.74449 XP_010337361.1.74449 XP_011232244.1.58354 XP_011232245.1.58354 XP_011817797.1.43180 XP_011817798.1.43180 XP_011817799.1.43180 XP_011822383.1.47321 XP_011822384.1.47321 XP_011822385.1.47321 XP_011888273.1.92194 XP_011888277.1.92194 XP_011888287.1.92194 XP_011888294.1.92194 XP_012921055.1.39548 XP_012921056.1.39548 XP_012921057.1.39548 XP_013970166.1.84170 XP_014321807.1.53796 XP_014397687.1.60319 XP_014585721.1.31192 XP_014585722.1.31192 XP_014649033.1.5094 XP_014649035.1.5094 XP_014704469.1.49734 XP_014704470.1.49734 XP_014704471.1.49734 XP_014704473.1.49734 XP_014704474.1.49734 XP_014980868.1.72884 XP_015297914.1.63531 XP_015297915.1.63531 XP_015419504.1.95426 XP_015419506.1.95426 XP_015853147.1.50099 XP_016878363.1.92137 XP_017172851.1.92730 XP_017834121.1.60252 XP_017834122.1.60252 XP_017834123.1.60252 XP_017834124.1.60252 XP_018867578.1.27298 XP_018867579.1.27298 XP_018867580.1.27298 XP_019568702.1.88060 XP_019568703.1.88060 XP_019568704.1.88060 XP_019568705.1.88060 XP_019568706.1.88060 XP_019568707.1.88060 XP_019568709.1.88060 XP_019568710.1.88060 XP_019662846.1.58354 XP_019662847.1.58354 XP_019662848.1.58354 XP_021500443.1.76796 XP_021500445.1.76796 XP_021553750.1.83697 XP_537005.1.84170 ENSMUSP00000085867 ENSTTRP00000007784 ENSCAFP00000028673 ENSMMUP00000025281 9544.ENSMMUP00000025283 9606.ENSP00000315859 gi|18379334|ref|NP_542161.1| gi|6857826|ref|NP_006702.1| ENSMMUP00000025282 ENSMMUP00000025283 ENSP00000301730 ENSMLUP00000015315 ENSCAFP00000028673 ENSMLUP00000015315 ENSMUSP00000085867 ENSMUSP00000126345 ENSAMEP00000018865 hsi002003798.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]