SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70167113|ref|NP_001020278.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70167113|ref|NP_001020278.1|
Domain Number 1 Region: 199-275
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.45e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0015
Further Details:      
 
Domain Number 2 Region: 309-389
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.47e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0035
Further Details:      
 
Domain Number 3 Region: 424-501
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.97e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0025
Further Details:      
 
Domain Number 4 Region: 2-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-16
Family Z-DNA binding domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70167113|ref|NP_001020278.1|
Sequence length 931
Comment double-stranded RNA-specific adenosine deaminase isoform d [Homo sapiens]
Sequence
MAEIKEKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHL
TDKKRERMQIKRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEP
VIKLENRQEARPEPARLKPPVHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRA
IMEMPSFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRF
KFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKAKDSGKSEESSHYSTEKESEK
TAESQTPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPKFQYCVAVGAQ
TFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRK
IGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAH
SKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPL
TGSTFHDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVK
GDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTV
SFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFENPKQGKLRTKVENGEGTIPVES
SDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGH
LTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYD
LEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETA
KNYFKKGLKDMGYGNWISKPQEEKNFYLCPV
Download sequence
Identical sequences gi|301601658|ref|NP_001180424.1| gi|70167113|ref|NP_001020278.1| ENSP00000357456 ENSP00000357456 NP_001020278.1.87134 NP_001020278.1.92137 NP_001180424.1.87134 NP_001180424.1.92137 XP_006711174.1.92137 XP_006711175.1.92137 XP_006711176.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]