SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70995267|ref|NP_775776.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70995267|ref|NP_775776.2|
Domain Number 1 Region: 17-274
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.9e-65
Family Ankyrin repeat 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70995267|ref|NP_775776.2|
Sequence length 301
Comment ankyrin repeat domain-containing protein 29 [Homo sapiens]
Sequence
MCRMSFKKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHID
CVRELVLQGADINLQRESGTTALFFAAQQGHNDVVRFLFGFGASTEFRTKDGGTALLAAS
QYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRQDGTA
PLWIASQMGHSEVVRVMLLRGADRDAARNDGTTALLKAANKGYNDVIKELLKFSPTLGIL
KNGTSALHAAVLSGNIKTVALLLEAGADPSLRNKANELPAELTKNERILRLLRSKEGPRK
S
Download sequence
Identical sequences Q8N6D5
NP_775776.2.87134 NP_775776.2.92137 ENSP00000468354 9606.ENSP00000323387 ENSP00000468354 gi|70995267|ref|NP_775776.2| ENSP00000284207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]