SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71051598|ref|NP_057159.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71051598|ref|NP_057159.2|
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-39
Family VPS36 N-terminal domain-like 0.000000299
Further Details:      
 
Domain Number 2 Region: 277-385
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-29
Family MarR-like transcriptional regulators 0.073
Further Details:      
 
Domain Number 3 Region: 189-311
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000141
Family Vacuolar sorting protein domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71051598|ref|NP_057159.2|
Sequence length 386
Comment vacuolar protein-sorting-associated protein 36 [Homo sapiens]
Sequence
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMA
ILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYR
RLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP
LRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQS
Download sequence
Identical sequences A0A2J8SSK1 G3QYH7 H2Q7L7 Q86VN1
GO.37144 ENSPTRP00000010034 9598.ENSPTRP00000010034 9606.ENSP00000367299 ENSP00000367299 ENSPTRP00000010034 ENSGGOP00000007913 ENSP00000367299 NP_057159.2.87134 NP_057159.2.92137 XP_004054603.1.27298 XP_509796.2.37143 ENSP00000367299 ENSGGOP00000007913 gi|71051598|ref|NP_057159.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]