SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71834870|ref|NP_001025190.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|71834870|ref|NP_001025190.1|
Domain Number - Region: 239-352
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0247
Family APC10-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71834870|ref|NP_001025190.1|
Sequence length 357
Comment SUN domain-containing protein 3 [Homo sapiens]
Sequence
MSGKTKARRAAMFFRRCSEDASGSASGNALLSEDENPDANGVTRSWKIILSTMLTLTFLL
VGLLNHQWLKETDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNF
RQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVNYVLKKLRED
QVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCW
AFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
GQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVHGTPGKHI
Download sequence
Identical sequences Q8TAQ9
gi|71834868|ref|NP_689995.3| gi|71834870|ref|NP_001025190.1| NP_001025190.1.87134 NP_001025190.1.92137 NP_689995.3.87134 NP_689995.3.92137 XP_016867419.1.92137 ENSP00000297325 ENSP00000378939 9606.ENSP00000297325 ENSP00000297325 ENSP00000378939 ENSP00000297325 NYSGRC-71834870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]