SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|74024893|ref|NP_001010978.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74024893|ref|NP_001010978.2|
Domain Number 1 Region: 75-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 162-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000851
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|74024893|ref|NP_001010978.2|
Domain Number - Region: 127-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|74024893|ref|NP_001010978.2|
Sequence length 205
Comment low-density lipoprotein receptor class A domain-containing protein 1 [Homo sapiens]
Sequence
MNKVFPQGENGYTAAESKAHPGGEAGGGHLCCSRRGACLSASLLLLLATVAALIALVTIL
GLPSCTPGAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSL
PHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSPVTVCPPCGPGWWRCPSTFFKYCDC
IPRHLCRDHVQHCSDWSDEYACPGP
Download sequence
Identical sequences Q5T700
NP_001010978.2.87134 NP_001010978.2.92137 gi|74024893|ref|NP_001010978.2| 9606.ENSP00000360411 ENSP00000360413 ENSP00000360411 ENSP00000360411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]