SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|74027265|ref|NP_001027539.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74027265|ref|NP_001027539.1|
Domain Number 1 Region: 365-427
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0053
Further Details:      
 
Domain Number 2 Region: 240-303
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 3 Region: 318-356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|74027265|ref|NP_001027539.1|
Domain Number - Region: 213-242
Classification Level Classification E-value
Superfamily PKD domain 0.0102
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|74027265|ref|NP_001027539.1|
Sequence length 513
Comment kunitz-type protease inhibitor 1 isoform 2 precursor [Homo sapiens]
Sequence
MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPG
FVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
CLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLV
LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC
RGVQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGF
DELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQ
CLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKNQRKDFH
GHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL
Download sequence
Identical sequences A0A2J8QDP5
ENSP00000409935 ENSP00000457076 gi|4504329|ref|NP_003701.1| gi|74027265|ref|NP_001027539.1| ENSP00000457076 NP_001027539.1.87134 NP_001027539.1.92137 NP_003701.1.87134 NP_003701.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]