SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|74315356|ref|NP_037408.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74315356|ref|NP_037408.2|
Domain Number 1 Region: 7-267
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.3e-42
Family Glycerol kinase 0.0091
Further Details:      
 
Domain Number 2 Region: 6-104,257-337,374-467
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.00000000000792
Family ATPase domain of dehydratase reactivase alpha subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|74315356|ref|NP_037408.2|
Sequence length 478
Comment sedoheptulokinase [Homo sapiens]
Sequence
MAARPITLGIDLGTTSVKAALLRAAPDDPSGFAVLASCARAARAEAAVESAVAGPQGREQ
DVSRILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRA
VSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHD
YVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRT
SHMWFEIPKGTQVGVALGDLQASVYSCMAQRTDAVLNISTSVQLAASMPSGFQPAQTPDP
TAPVAYFPYFNRTYLGVAASLNGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAVQ
QRDTHLTITPTVLGERHLPDQLASVTRISSSDLSLGHVTRALCRGIVQNLHSMLPIQQLQ
EWGVERVMGSGSALSRNDVLKQEVQRAFPLPMSFGQDVDAAVGAALVMLRRHLNQKES
Download sequence
Identical sequences A0A0B4J2A0
gi|74315356|ref|NP_037408.2| NP_037408.2.87134 NP_037408.2.92137 ENSP00000225519 ENSP00000461416 GO.36865 HR3015 HR6476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]