SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75750529|ref|NP_057636.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75750529|ref|NP_057636.2|
Domain Number 1 Region: 518-615,648-728
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.11e-23
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 2-100
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.97e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 266-336
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000155
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 876-925
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000436
Family MYND zinc finger 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75750529|ref|NP_057636.2|
Sequence length 941
Comment ankyrin repeat and MYND domain-containing protein 1 isoform 1 [Homo sapiens]
Sequence
MYQGEFGLNMKLGYGKFSWPTGESYHGQFYRDHCHGLGTYMWPDGSSFTGTFYLSHREGY
GTMYMKTRLFQGLYKADQRFGPGVETYPDGSQDVGLWFREQLIKLCTQIPSGFSLLRYPE
FSSFITHSPARISLSEEEKTEWGLQEGQDPFFYDYKRFLLNDNLTLPPEMYVYSTNSDHL
PMTSSFRKELDARIFLNEIPPFVEDGEPWFIINETPLLVKIQKQTYKFRNKPAHTSWNMG
AILEGKRSGFAPCGPKEQLSMEMILKAEEGNHEWICRILKDNFASADVADAKGYTVLAAA
ATHCHNDIVNLLLDCGADVNKCSDEGLTALSMCFLLHYPAQSFKPNVAERTIPEPQEPPK
FPVVPILSSSFMDTNLESLYYEVNVPSQGSYELRPPPAPLLLPRVSGSHEGGHFQDTGQC
GGSIDHRSSSLKGDSPLVKGSLGHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIE
LSQAMLERSAQSHSLLKMASPSPCTSSFDKGTMRRMALSMIERRKRWRTIKLLLRRGADP
NLCCVPMQVLFLAVKAGDVDGVRLLLEHGARTDICFPPQLSTLTPLHIAAALPGEEGVQI
VELLLHAITDVDAKASDEDDTYKPGKLDLLPSSLKLSNEPGPPQAYYSTDTALPEEGGRT
ALHMACEREDDNKCARDIVRLLLSHGANPNLLWSGHSPLSLSIASGNELVVKELLTQGAD
PNLPLTKGLGSALCVACDLTYEHQRNMDSKLALIDRLISHGADILKPVMLRQGEKEAVGT
AVDYGYFRFFQDRRIARCPFHTLMPAERETFLARKRLLEYMGLQLRQAVFAKESQWDPTW
LYLCKRAELIPSHRMKKKGPSLPRGLDVKEQGQIPFFKFCYQCGRSIGVRLLPCPRCYGI
LTCSKYCKTKAWTEFHKKDCGDLVAIVTQLEQVSRRREEFQ
Download sequence
Identical sequences Q9P2S6
gi|75750529|ref|NP_057636.2| ENSP00000272972 NP_057636.2.87134 NP_057636.2.92137 ENSP00000272972 ENSP00000375847 9606.ENSP00000272972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]