SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75750531|ref|NP_060314.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75750531|ref|NP_060314.2|
Domain Number 1 Region: 85-157
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000549
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 370-540
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000187
Family Ankyrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 652-701
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000314
Family MYND zinc finger 0.0098
Further Details:      
 
Domain Number 4 Region: 162-194
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000746
Family Ankyrin repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75750531|ref|NP_060314.2|
Sequence length 717
Comment ankyrin repeat and MYND domain-containing protein 1 isoform 2 [Homo sapiens]
Sequence
MEGAHASLSLEDEVSGAGSRQRPLEGKGGETPAAEEPGSLKNYAVFATRDVSAAPEKEEE
EAEGPLRAQDLRESYIQLVQGVQEWQDGCMYQGEFGLNMKLGYGKFSWPTGESYHGQFYR
DHCHGLGTYMWPDGSSFTGTFYLSHREGYGTMYMKTRLFQTHCHNDIVNLLLDCGADVNK
CSDEGLTALSMCFLLHYPAQSFKPNVAERTIPEPQEPPKFPVVPILSSSFMDTNLESLYY
EVNVPSQGSYELRPPPAPLLLPRVSGSHEGGHFQDTGQCGGSIDHRSSSLKGDSPLVKGS
LGHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIELSQAMLERSAQSHSLLKMASP
SPCTSSFDKGTMRRMALSMIERRKRWRTIKLLLRRGADPNLCCVPMQVLFLAVKAGDVDG
VRLLLEHGARTDICFPPQLSTLTPLHIAAALPGEEGVQIVELLLHAITDVDAKASDEDDT
YKPGKVVKELLTQGADPNLPLTKGLGSALCVACDLTYEHQRNMDSKLALIDRLISHGADI
LKPVMLRQGEKEAVGTAVDYGYFRFFQDRRIARCPFHTLMPAERETFLARKRLLEYMGLQ
LRQAVFAKESQWDPTWLYLCKRAELIPSHRMKKKGPSLPRGLDVKEQGQIPFFKFCYQCG
RSIGVRLLPCPRCYGILTCSKYCKTKAWTEFHKKDCGDLVAIVTQLEQVSRRREEFQ
Download sequence
Identical sequences NP_060314.2.87134 NP_060314.2.92137 ENSP00000355097 gi|75750531|ref|NP_060314.2| ENSP00000355097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]