SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76443679|ref|NP_060043.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76443679|ref|NP_060043.2|
Domain Number 1 Region: 116-446
Classification Level Classification E-value
Superfamily Subtilisin-like 6.15e-96
Family Subtilases 0.000000000237
Further Details:      
 
Domain Number 2 Region: 440-581
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-40
Family Proprotein convertase P-domain 0.0000177
Further Details:      
 
Domain Number 3 Region: 34-105
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.56e-17
Family Prohormone convertase 1 pro-domain 0.014
Further Details:      
 
Domain Number 4 Region: 595-686
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000518
Family Growth factor receptor domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76443679|ref|NP_060043.2|
Sequence length 755
Comment proprotein convertase subtilisin/kexin type 4 precursor [Homo sapiens]
Sequence
MRPAPIALWLRLVLALALVRPRAVGWAPVRAPIYVSSWAVQVSQGNREVERLARKFGFVN
LGPIFPDGQYFHLRHRGVVQQSLTPHWGHRLHLKKNPKVQWFQQQTLQRRVKRSVVVPTD
PWFSKQWYMNSEAQPDLSILQAWSQGLSGQGIVVSVLDDGIEKDHPDLWANYDPLASYDF
NDYDPDPQPRYTPSKENRHGTRCAGEVAAMANNGFCGVGVAFNARIGGVRMLDGTITDVI
EAQSLSLQPQHIHIYSASWGPEDDGRTVDGPGILTREAFRRGVTKGRGGLGTLFIWASGN
GGLHYDNCNCDGYTNSIHTLSVGSTTQQGRVPWYSEACASTLTTTYSSGVATDPQIVTTD
LHHGCTDQHTGTSASAPLAAGMIALALEANPFLTWRDMQHLVVRASKPAHLQAEDWRTNG
VGRQVSHHYGYGLLDAGLLVDTARTWLPTQPQRKCAVRVQSRPTPILPLIYIRENVSACA
GLHNSIRSLEHVQAQLTLSYSRRGDLEISLTSPMGTRSTLVAIRPLDVSTEGYNNWVFMS
THFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRD
TEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCR
GGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLG
GPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Download sequence
Identical sequences A0A140VJQ9 Q6UW60
ENSP00000300954 gi|76443679|ref|NP_060043.2| ENSP00000300954 NP_060043.2.87134 NP_060043.2.92137 ENSP00000300954 9606.ENSP00000300954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]