SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7662350|ref|NP_054860.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662350|ref|NP_054860.1|
Domain Number 1 Region: 43-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 156-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-38
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 973-1185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 4 Region: 792-966
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-34
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 367-558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-33
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 6 Region: 584-642
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000733
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 7 Region: 555-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000194
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7662350|ref|NP_054860.1|
Sequence length 1331
Comment contactin-associated protein-like 2 precursor [Homo sapiens]
Sequence
MQAAPRAGCGAALLLWIVSSCLCRAWTAPSTSQKCDEPLVSGLPHVAFSSSSSISGSYSP
GYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDT
GRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPIIARYVRIVPLDWNGEGRIGLRIEVYG
CSYWADVINFDGHVVLPYRFRNKKMKTLKDVIALNFKTSESEGVILHGEGQQGDYITLEL
KKAKLVLSLNLGSNQLGPIYGHTSVMTGSLLDDHHWHSVVIERQGRSINLTLDRSMQHFR
TNGEFDYLDLDYEITFGGIPFSGKPSSSSRKNFKGCMESINYNGVNITDLARRKKLEPSN
VGNLSFSCVEPYTVPVFFNATSYLEVPGRLNQDLFSVSFQFRTWNPNGLLVFSHFADNLG
NVEIDLTESKVGVHINITQTKMSQIDISSGSGLNDGQWHEVRFLAKENFAILTIDGDEAS
AVRTNSPLQVKTGEKYFFGGFLNQMNNSSHSVLQPSFQGCMQLIQVDDQLVNLYEVAQRK
PGSFANVSIDMCAIIDRCVPNHCEHGGKCSQTWDSFKCTCDETGYSGATCHNSIYEPSCE
AYKHLGQTSNYYWIDPDGSGPLGPLKVYCNMTEDKVWTIVSHDLQMQTPVVGYNPEKYSV
TQLVYSASMDQISAITDSAEYCEQYVSYFCKMSRLLNTPDGSPYTWWVGKANEKHYYWGG
SGPGIQKCACGIERNCTDPKYYCNCDADYKQWRKDAGFLSYKDHLPVSQVVVGDTDRQGS
EAKLSVGPLRCQGDRNYWNAASFPNPSSYLHFSTFQGETSADISFYFKTLTPWGVFLENM
GKEDFIKLELKSATEVSFSFDVGNGPVEIVVRSPTPLNDDQWHRVTAERNVKQASLQVDR
LPQQIRKAPTEGHTRLELYSQLFVGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFI
SGCSGHCTSYGTNCENGGKCLERYHGYSCDCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQ
APATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVK
PTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPS
SSDTLFNSPKSLFLGKVIETGKIDQEIHKYNTPGFTGCLSRVQFNQIAPLKAALRQTNAS
AHVHIQGELVESNCGASPLTLSPMSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRN
SAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTE
TIDESKKEWLI
Download sequence
Identical sequences A0A090N7T7 Q9UHC6
gi|7662350|ref|NP_054860.1| ENSP00000354778 ENSP00000354778 ENSP00000354778 9606.ENSP00000354778 NP_054860.1.87134 NP_054860.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]