SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662352|ref|NP_055776.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662352|ref|NP_055776.1|
Domain Number 1 Region: 66-231
Classification Level Classification E-value
Superfamily RUN domain-like 4.71e-54
Family RUN domain 0.000000026
Further Details:      
 
Weak hits

Sequence:  gi|7662352|ref|NP_055776.1|
Domain Number - Region: 271-318
Classification Level Classification E-value
Superfamily Prefoldin 0.00112
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7662352|ref|NP_055776.1|
Sequence length 469
Comment protein RUFY3 isoform 2 [Homo sapiens]
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYM
KALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELA
VANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE
KELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH
Download sequence
Identical sequences A0A024RDD7 A0A2I2Z410 A0A2I3NCK7 A0A2J8UTR2 A0A2K5X3T8 A0A2K6AI32 H9EPE9 K7AUE1 Q7L099
ENSP00000226328 ENSP00000226328 gi|7662352|ref|NP_055776.1| NP_055776.1.87134 NP_055776.1.92137 XP_005555188.1.63531 XP_007997008.1.81039 XP_008959396.1.60992 XP_009446052.1.37143 XP_011853542.1.47321 XP_014994059.1.72884 XP_018880963.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]