SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7662655|ref|NP_054754.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662655|ref|NP_054754.1|
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily PX domain 1.74e-24
Family PX domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7662655|ref|NP_054754.1|
Sequence length 169
Comment sorting nexin-24 [Homo sapiens]
Sequence
MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPS
KHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDET
ESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
Download sequence
Identical sequences A0A286ZU39 A0A2K6F2K5 K7BXA9 Q9Y343
ENSSSCP00000026845 NP_054754.1.87134 NP_054754.1.92137 XP_003123920.3.46622 XP_003800007.1.62490 XP_004267475.1.21590 XP_006216560.1.17985 XP_006886059.1.29581 XP_012519779.1.63892 XP_012644011.1.48125 XP_014715047.1.49734 XP_019325095.1.44245 XP_019796458.1.83887 XP_517896.1.37143 GO.33786 hsi002012121.1 ENSP00000261369 gi|7662655|ref|NP_054754.1| ENSP00000261369 ENSSSCP00000026845 9606.ENSP00000261369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]