SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76880472|ref|NP_954714.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76880472|ref|NP_954714.2|
Domain Number 1 Region: 107-202
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-37
Family Forkhead DNA-binding domain 0.00000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76880472|ref|NP_954714.2|
Sequence length 416
Comment forkhead box protein D4-like 4 [Homo sapiens]
Sequence
MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEARQQFLEQSLQPGLQ
VARWGGVALPREHIEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMA
ILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGN
YWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPHPGPLLGAP
APPQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSARVYAGAPKKAEGADLATPAPFPCCS
PHLVLSLGRRARVWRRHREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQ
ACCIPKPLPLCCKCPPPLLLGQFCSNSSSIRRTAPTAALPPRARCWAGTCRPRRRC
Download sequence
Identical sequences Q8WXT5
ENSP00000366630 ENSP00000366814 ENSP00000366630 9606.ENSP00000366630 9606.ENSP00000366814 NP_954714.2.87134 NP_954714.2.92137 gi|149944560|ref|NP_001092749.1| gi|76880472|ref|NP_954714.2| ENSP00000366630 ENSP00000366814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]