SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7705294|ref|NP_057272.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7705294|ref|NP_057272.1|
Domain Number 1 Region: 161-212,246-425
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.08e-62
Family Actin/HSP70 0.0000109
Further Details:      
 
Domain Number 2 Region: 9-167
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.53e-43
Family Actin/HSP70 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7705294|ref|NP_057272.1|
Sequence length 426
Comment actin-like protein 6B [Homo sapiens]
Sequence
MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEK
KGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMS
EAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVH
DGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKL
PQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLR
IPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDR
LNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQC
VERKCP
Download sequence
Identical sequences A0A096P0C3 A0A0D9RZB2 A0A2J8XUQ6 A0A2K5E745 A0A2K5IEW6 A0A2K5Q9J7 A0A2K5WNS5 A0A2K5YGJ7 A0A2K6CKT3 A0A2K6Q927 A0A2K6S016 F7FRF7 G7MNV3 H2QV38 O94805
ENSCJAP00000027896 ENSCJAP00000027896 ENSP00000160382 ENSPTRP00000033382 ENSPTRP00000033382 NP_001253215.1.72884 NP_057272.1.87134 NP_057272.1.92137 XP_001140943.2.37143 XP_002744041.1.60252 XP_003934225.1.74449 XP_005549302.1.63531 XP_008016719.1.81039 XP_008963668.1.60992 XP_010376030.1.97406 XP_011765991.1.29376 XP_011799313.1.43180 XP_011841062.1.47321 XP_012330217.1.9421 XP_016813396.1.37143 XP_017389065.1.71028 gi|7705294|ref|NP_057272.1| ENSPANP00000018798 Hs7705294___KOG0679 ENSP00000160382 ENSP00000160382 9606.ENSP00000160382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]