SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7706379|ref|NP_057200.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7706379|ref|NP_057200.1|
Domain Number 1 Region: 22-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-47
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 374-421
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000235
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7706379|ref|NP_057200.1|
Sequence length 426
Comment ankyrin repeat and SOCS box protein 4 isoform a [Homo sapiens]
Sequence
MDGTTAPVTKSGAAKLVKRNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDENMVLASY
KQGYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANV
DCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLH
TAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLD
YKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRP
AAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPD
DDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRAIPLLSLPLSLKKYLLLE
PEGIIY
Download sequence
Identical sequences G3QUG4 H2PMV9 Q9Y574
9600.ENSPPYP00000019953 9606.ENSP00000321388 ENSP00000321388 ENSGGOP00000006366 gi|7706379|ref|NP_057200.1| NP_057200.1.87134 NP_057200.1.92137 XP_002818286.1.23681 XP_004045831.1.27298 ENSP00000321388 ENSPPYP00000019953 ENSPPYP00000019953 ENSP00000321388 ENSGGOP00000006366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]