SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7706625|ref|NP_057236.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7706625|ref|NP_057236.1|
Domain Number 1 Region: 18-296
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-78
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7706625|ref|NP_057236.1|
Sequence length 336
Comment retinoic acid receptor beta isoform 2 [Homo sapiens]
Sequence
MIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYE
MTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKI
VEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHN
AGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEAL
KIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
HEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Download sequence
Identical sequences A0A2J8WZ11 A0A2K5JFE1 A0A2K5WS52 A0A2K5Z0D4 A0A2K6DR34 A0A2K6KJY9 H2QM72 I2CTI3 Q5QHG3
ENSP00000391391 ENSP00000398840 NP_001277146.1.87134 NP_001277146.1.92137 NP_001277205.1.87134 NP_001277205.1.92137 NP_057236.1.87134 NP_057236.1.92137 XP_009443304.1.37143 XP_009443305.1.37143 XP_009443306.1.37143 XP_011751756.1.29376 XP_011811638.1.43180 XP_011811639.1.43180 XP_011811640.1.43180 XP_011830196.1.47321 XP_011830197.1.47321 XP_011830199.1.47321 XP_011899228.1.92194 XP_011899229.1.92194 XP_015300510.1.63531 XP_017748896.1.44346 ENSP00000391391 ENSP00000398840 gi|7706625|ref|NP_057236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]