SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7706643|ref|NP_057529.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7706643|ref|NP_057529.1|
Domain Number 1 Region: 126-232
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-28
Family DEP domain 0.00000352
Further Details:      
 
Domain Number 2 Region: 238-351
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-25
Family Pleckstrin-homology domain (PH domain) 0.00000202
Further Details:      
 
Domain Number 3 Region: 4-136
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-25
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7706643|ref|NP_057529.1|
Sequence length 353
Comment pleckstrin-2 [Homo sapiens]
Sequence
MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITC
PCLEYENRPLLIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNS
FKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEA
VTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLS
TVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSL
VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT
Download sequence
Identical sequences Q9NYT0
9606.ENSP00000216446 ENSP00000216446 ENSP00000216446 ENSP00000216446 NP_057529.1.87134 NP_057529.1.92137 gi|7706643|ref|NP_057529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]