SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8051595|ref|NP_057738.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8051595|ref|NP_057738.1|
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.2e-49
Family Ankyrin repeat 0.0000000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|8051595|ref|NP_057738.1|
Sequence length 383
Comment GA-binding protein subunit beta-1 isoform beta 2 [Homo sapiens]
Sequence
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTDETGVSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEEVV
TAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPA
TDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKE
QEAEAYRQKLEAMTRLQTNKEAV
Download sequence
Identical sequences A0A024R5X6 A0A0D9REY8 A0A1S2ZCR8 A0A1S3EMI0 A0A287AJN5 A0A2J8VBI4 A0A2K6NJV5 E2RLV1 F6Z4A0 I0FQK3 K7AEU9 K9IJ68 Q1RMI3 Q4R3Q2 U3DAM2
ENSCAFP00000022272 ENSP00000370259 ENSSTOP00000014445 NP_001069272.1.59421 NP_001069272.1.76553 NP_001181566.1.72884 NP_001270774.1.63531 NP_057738.1.87134 NP_057738.1.92137 XP_001168421.1.37143 XP_002753522.1.60252 XP_003266958.1.23891 XP_003480413.1.46622 XP_003586626.3.76553 XP_003784396.1.62490 XP_003928909.1.74449 XP_004281331.1.21590 XP_004421625.1.5094 XP_004611835.1.94378 XP_005316615.1.77405 XP_005602660.1.31192 XP_005685842.1.57651 XP_005892228.1.15283 XP_005979925.1.78601 XP_006181366.1.101512 XP_006208414.1.17985 XP_006920433.1.64745 XP_007115978.1.24612 XP_007170476.1.59432 XP_007455591.1.90284 XP_007517400.1.11023 XP_008014827.1.81039 XP_008512076.1.77740 XP_010354913.1.97406 XP_010963602.1.22495 XP_010994123.1.51371 XP_011353399.1.92234 XP_011754526.1.29376 XP_011754535.1.29376 XP_011851153.1.47321 XP_011920711.1.92194 XP_012618959.1.48125 XP_012657404.1.62490 XP_012865571.1.60039 XP_012929897.1.39548 XP_012929899.1.39548 XP_014708031.1.49734 XP_014997691.1.72884 XP_015320604.1.59421 XP_015336163.1.40921 XP_015392917.1.5354 XP_015984107.1.101085 XP_015984109.1.101085 XP_016877542.1.92137 XP_017203509.1.1745 XP_017400406.1.71028 XP_017751680.1.44346 XP_017909675.1.57651 XP_019520294.1.44202 XP_019520312.1.44202 XP_019586226.1.88060 XP_019688001.1.62641 XP_019784899.1.83887 XP_019824413.1.53367 XP_020039231.1.5219 XP_020751513.1.74333 XP_020751515.1.74333 XP_020951382.1.46622 XP_862284.1.84170 ENSSSCP00000005005 ENSP00000370259 ENSECAP00000014517 ENSCAFP00000022272 ENSECAP00000014517 gi|8051595|ref|NP_057738.1| ENSSTOP00000014445 9796.ENSECAP00000014517 9913.ENSBTAP00000030917 ENSSSCP00000005005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]