SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8051599|ref|NP_057739.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8051599|ref|NP_057739.1|
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.08e-49
Family Ankyrin repeat 0.0000000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|8051599|ref|NP_057739.1|
Sequence length 348
Comment GA-binding protein subunit beta-1 isoform gamma 2 [Homo sapiens]
Sequence
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTDETGVSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEEVV
TAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPA
TDIAEETVISEEPPAKRQCIEIIENRVESAEIEVRSLLPGVLCRSHPK
Download sequence
Identical sequences A0A024R5R5 A0A2J8VBK5 K7BQS9
gi|32483404|ref|NP_852092.1| gi|8051599|ref|NP_057739.1| NP_057739.1.87134 NP_057739.1.92137 NP_852092.1.87134 NP_852092.1.92137 XP_001168234.1.37143 XP_003266961.1.23891 XP_003821513.1.60992 XP_003821515.1.60992 XP_005559592.1.63531 XP_008014829.1.81039 XP_011754543.1.29376 XP_011851154.1.47321 XP_011920712.1.92194 XP_014997695.1.72884 XP_017751683.1.44346 ENSP00000351923 ENSP00000379728 ENSP00000351923 ENSP00000379728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]