SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82659087|ref|NP_059347.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82659087|ref|NP_059347.2|
Domain Number 1 Region: 278-385
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.93e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.00014
Further Details:      
 
Domain Number 2 Region: 180-258
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.51e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.00037
Further Details:      
 
Domain Number 3 Region: 71-171
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000487
Family Double-stranded RNA-binding domain (dsRBD) 0.0099
Further Details:      
 
Weak hits

Sequence:  gi|82659087|ref|NP_059347.2|
Domain Number - Region: 486-555
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00215
Family Double-stranded RNA-binding domain (dsRBD) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82659087|ref|NP_059347.2|
Sequence length 577
Comment double-stranded RNA-binding protein Staufen homolog 1 isoform b [Homo sapiens]
Sequence
MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSAS
ITSTSAAAESITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPF
PVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN
LNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKN
AAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKE
KEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQ
PTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM
VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGH
VPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVES
CHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC
Download sequence
Identical sequences O95793
NP_001306064.1.87134 NP_001306064.1.92137 NP_001309858.1.87134 NP_001309858.1.92137 NP_001309859.1.87134 NP_001309859.1.92137 NP_059347.2.87134 NP_059347.2.92137 ENSP00000360922 ENSP00000360922 gi|82659087|ref|NP_059347.2| 9606.ENSP00000360922 ENSP00000323443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]