SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82659091|ref|NP_001032405.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82659091|ref|NP_001032405.1|
Domain Number 1 Region: 203-310
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.67e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.00014
Further Details:      
 
Domain Number 2 Region: 100-184
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000022
Family Double-stranded RNA-binding domain (dsRBD) 0.00052
Further Details:      
 
Domain Number 3 Region: 23-96
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000173
Family Double-stranded RNA-binding domain (dsRBD) 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|82659091|ref|NP_001032405.1|
Domain Number - Region: 411-480
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00165
Family Double-stranded RNA-binding domain (dsRBD) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|82659091|ref|NP_001032405.1|
Sequence length 502
Comment double-stranded RNA-binding protein Staufen homolog 1 isoform c [Homo sapiens]
Sequence
MKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGK
GKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVN
FESFPLKQVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPL
PAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPR
RREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPALKSEEKTPIK
KPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHH
TKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDY
LSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSE
LDQQSTEMPRTGNGPMSVCGRC
Download sequence
Identical sequences ENSP00000360867 ENSP00000360893 NP_001032405.1.87134 NP_001032405.1.92137 NP_001306063.1.87134 NP_001306063.1.92137 NP_001309856.1.87134 NP_001309856.1.92137 XP_005260584.1.92137 gi|82659091|ref|NP_001032405.1| ENSP00000360867 ENSP00000360893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]