SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82880658|ref|NP_057383.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82880658|ref|NP_057383.2|
Domain Number 1 Region: 189-380
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.62e-47
Family Actin/HSP70 0.0000196
Further Details:      
 
Domain Number 2 Region: 2-183
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.24e-46
Family Actin/HSP70 0.0000237
Further Details:      
 
Domain Number 3 Region: 386-507
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000000000000157
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82880658|ref|NP_057383.2|
Sequence length 509
Comment heat shock 70 kDa protein 14 isoform 1 [Homo sapiens]
Sequence
MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNI
SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI
FSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAY
GIGQDSPTGKSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLA
SEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARF
ELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNS
IPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT
PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVL
TMKRDGSLHVTCTDQETGKCEAISIEIAS
Download sequence
Identical sequences Q0VDF9
ENSP00000367623 9606.ENSP00000367623 ENSP00000309384 APC89504 ENSP00000367623 gi|82880658|ref|NP_057383.2| NP_057383.2.87134 NP_057383.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]